starboardsuite.com is a domain that was created on 2011-05-10,making it 13 years ago. It has several subdomains, such as riverboattwilight.starboardsuite.com atlanticparasail.starboardsuite.com , among others.
Description:Mobile-friendly reservation software for passenger vessels and water sports operators. Customized for your brand and your business. Set-up and training...
Discover starboardsuite.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site
HomePage size: 32.142 KB |
Page Load Time: 0.007596 Seconds |
Website IP Address: 23.253.57.47 |
Windsurfing Starts Here » Starboard Windsurfing windsurf.star-board.com |
Report Suite - Reporting Suite 2023 | AngloGold Ashanti reports.anglogoldashanti.com |
Water Testing Labs reviews | Order Real Estate Transfer Water Test or Water Testing Kit | Water anal reviews.wtlmd.com |
Jabra PC Suite Download - Jabra PC Suite has easy softphone integration jabra-pc-suite.software.informer.com |
Online reservation system & booking software Planyo api.planyo.com |
Citus™ Cobol Suite - FPT Software's COBOL transcoding tool suite cobol.fpt-software.com |
Pentair - Codeline | The global standard in pressure vessels codeline.pentair.com |
UCLA Stroke Center: Diagnostic, Therapeutic Stroke Care, Blood Vessels, Brain, Spinal Cord - Los Ang stroke.ucla.edu |
TUC'S | Potable Water | Waste Water Removal Services – Providing potable water & waste water removal tucs.tuccaro.com |
COUNTER NARCOTICS AND TERRORISM OPERATIONAL MEDICAL SUPPORT | Counter Narcotics and Terrorism Operat contoms.chepinc.org |
Sports Videos, Sports News, Athletes Twitter, Major League Sports Standings, Sports Search, Sports P sports.quickfound.net |
Mobile Medical Units for Mobile MRI, Mobile CT and Mobile PET/CT staging.amstcorp.com |
Welcome to Wansport.com – David Ensignia Tennis Academy – Online reservation and sports centers davidensigniatennisacademy.wansport.com |
VesTrak – Vessel Tracking and Data Visualization – Track vessels, visualize info.vestrak.com |
Starboard Suite Online and Mobile Reservation Software for ... https://www.starboardsuite.com/ |
Taste Carolina: Online Reservations https://tastecarolina.starboardsuite.com/ |
Water2Wine Cruises: Online Reservations https://water2winecruises.starboardsuite.com/ |
The Prairie Lily: Online Reservations https://theprairielily.starboardsuite.com/ |
Pittsburgh Party Pontoons: Online Reservations https://pittsburghpedalboats.starboardsuite.com/ |
Miss Naples: Online Reservations https://missnaples.starboardsuite.com/ |
Miss Augusta: Online Reservations https://missaugustaboat.starboardsuite.com/ |
San Diego Parasailing Adventures: Online Reservations https://goparasailing.starboardsuite.com/ |
Sip n' Sail Cruises: Online Reservations https://puremichiganboatcruises.starboardsuite.com/ |
Reservation Systems Overview | Starboard Suite Reservation System https://www.starboardsuite.com/solutions |
Starboard Suite Help Center https://support.starboardsuite.com/en/ |
FAQs | Starboard Suite Reservation System https://www.starboardsuite.com/faqs |
About | Starboard Suite Reservation System https://www.starboardsuite.com/about |
Introducing the Starboard Suite App Store! - Captain's Blog https://blog.starboardsuite.com/introducing-the-starboard-suite-app-store/ |
The Basics | Starboard Suite Help Center https://support.starboardsuite.com/en/collections/5918443-the-basics |
A starboardsuite.com. 300 IN A 23.253.57.47 |
MX starboardsuite.com. 300 IN MX 10 aspmx.l.google.com. |
NS starboardsuite.com. 21600 IN NS ns-1256.awsdns-29.org. |
TXT starboardsuite.com. 300 IN TXT facebook-domain-verification=uy6swvr9bppwdfop4c9dc25g7imog4 |
SOA starboardsuite.com. 900 IN SOA ns-1566.awsdns-03.co.uk. awsdns-hostmaster.amazon.com. 1 7200 900 1209600 86400 |
Date: Tue, 14 May 2024 13:03:47 GMT |
Server: Apache |
Strict-Transport-Security: max-age=31536000 |
X-Powered-By: PHP/7.3.33 |
Cache-Control: no-cache |
Set-Cookie: XSRF-TOKEN=eyJpdiI6IjMrOUdzOHVtMXZmdHZleGFUNmkyamc9PSIsInZhbHVlIjoiQ1wvWFhlSUlUbldMdVE4czhSbThXbVM5WUJRYkI2TFdwaXBhN1BFc3U0djM1NGlEYVBZNm42VW5VMUpKeHZLQURWVnhEdXE1ZXdzUTFOU0IrU3RJS2FBPT0iLCJtYWMiOiJkMmFjNTQ0MzUyMzYzODQ1MjcwM2VhZmM1Yjc2MzBjNDVmZTExYzk4ZTQ4NDM5NjljYmQ0Y2M1M2FhM2ViNDVlIn0%3D; expires=Tue, 14-May-2024 15:03:47 GMT; Max-Age=7200; path=/, laravel_session=eyJpdiI6InlkZGZiUE8rTG1HVUVGcVBUVGE2Y1E9PSIsInZhbHVlIjoiRUI4UlN1aFdORGE1U21JRWdobEFoTXREK1k0ZXJqanBlaUNPUDdQNEMrZmg5dEs5NFd6MjBGMjJQelM3S1wvejc0a1wvZEhHMVN5Y0Z5c2k5dGduZ0lLZz09IiwibWFjIjoiMDg4MzU0ODQ1MzM2NzE3ZTM3NGNiZWUyYTNhNjY3ZjBjMDhiZGIxZDZkMjY1MzU1NmU2OWJjOThhYTFkNjNiYyJ9; expires=Tue, 14-May-2024 15:03:47 GMT; Max-Age=7200; path=/; HttpOnly |
Vary: Accept-Encoding |
Transfer-Encoding: chunked |
Content-Type: text/html; charset=UTF-8 |
content="Starboard Suite Reservation System" property="og:title"/ |
content="http://www.starboardsuite.com" property="og:url"/ |
content="http://www.starboardsuite.com/img/StarboardSuite_Logo_WaveOnly.png" property="og:image"/ |
charset="utf-8"/ |
content="21xnyeaof8ucazrohit6pgkbpja3hsulw8fqtqkwl562pubnnqne7dwj450g6v0mgssdf5nwqi2c1api6ogh8t74uvswg4fu1fdjrrtojm4-b4x395gguymoy98l-0zx" name="norton-safeweb-site-verification"/ |
content="Mobile-friendly reservation software for passenger vessels and water sports operators. Customized for your brand and your business. Set-up and training included." name="description"/ |
content="width=device-width, initial-scale=1" name="viewport"/ |
Ip Country: United States |
Latitude: 37.751 |
Longitude: -97.822 |
ors | Starboard Suite Reservation SystemThis website uses cookies Cookies help us personalize content and understand how visitors use our website. By browsing this website, you agree to our use of cookies. Learn more Got it, thanks. Menu Home Solutions Overview For Dinner, Lunch & Sightseeing Cruises For Private Charters & Group Bookings For Whale & Dolphin Watching Tours For Cycle Boats, Tiki Boats and Party Pontoons For Banana Boats, Parasailing & More Starboard Suite Kiosk Starboard Suite Ticket Scanner Integrations Overview Stripe Authorize.Net SmartWaiver TripAdvisor Viator MailChimp Constant Contact Google Analytics Google Ads Facebook Pixel Ad Roll Pricing FAQs compare Overview Compare with Peek Compare with FareHarbor Compare with Xola Company About News schedule a demo Talk With an Expert Effortless Reservations + Ticketing for Passenger Vessels and Water Sports More Information schedule a free demo Effortless Contracts for Private Charters and Group Bookings More Information schedule a free demo 24/7 Online Booking With Real-Time Availability Automated Confirmation and Follow-up Emails Marketing and Search Engine Optimization (SEO) Personalized Set-up, Training and Support Included Custom PDF Contracts With Versioning Support for Private Charters, Schools and Tour Groups Detailed Reports for Event Planning and Financial Tracking Resource Tracking for Multi-use Inventory 100% web-based so there’s nothing to install. Works on your desktop, laptop, tablet or smartphone. Starboard Suite is perfect for... LUNCH, DINNER & SIGHTSEEING CRUISES LEARN MORE CHARTER CRUISES LEARN MORE WHALE & DOLPHIN WATCHING LEARN MORE CYCLE BOATS, TIKI BOATS AND PARTY PONTOONS LEARN MORE PARASAILING, BANANA BOATS & MORE LEARN MORE And the winner is . . . Starboard Suite! Award-winning reservation software that’s powerful and incredibly easy to use. Starboard Suite is Integrated WithCustomized for your brand and your business You’ve worked hard to build your brand. Strengthen it with a reservation system that matches your website, not ours . Starboard Suite is a platform that we customize to match your brand and your specific business needs. We set everything up, train you and your staff, and provide support and free updates for as long as you’re a customer. I don’t know how a tour operator could run their business without it! Arrit McPherson — Owner, San Diego Parasailing Read Case StudyIt’s very easy to learn and love the control I have to change information on site instantly! Amy Lindquist — Manager, Munising Bay Shipwreck Tours Read Case StudyI have mentioned Starboard Suite to all of my friends! John Graff — Owner, Thundercat Speedboat and Dolphin Watch Read Case StudyIt’s a great business tool, has decreased my phone calls by 30%, while maintaining the same or better volume of customers. Matt Traber — Owner, Atlantic Parasail, Inc Read Case StudyOur company has some very specific wants and needs and the Starboard team has been able to accommodate every one. Carrie Stier — Owner, River Cruises Read Case StudyStarboard Suite has been good to work with, they are honest and professional. Response time is fast and solutions happen. Doris Armacost — Owner, McCall Lake Cruises Read Case StudyThe team at Starboard are fantastic! They truly care about your business. They will do whatever they can to help make you successful and make sure the systems works best for your business. Their service is first class. Jenny Gezella — President, Naples Princess Read Case StudyMy company started using this software 2 years ago and we have only positive things to say about it. The customer service is very helpful anytime we need. Overall we love the system. Taylor Withrow — Owner/Operator, Island Head Watersports Read Case StudyGreatest Customer Service in the World!! We have been using Starboard Suite for over two years and find it to be user friendly, easy to adapt to changes in our business, and of over the top customer service. I would highly recommend this system to anyone. Tom Berg — Owner, Paradise Watersports Read Case StudyGreat tool literally tailored to our business! Starboard Suite has been a tremendous asset to our business. We would highly recommend them to anyone. Lauren Porter — Manager, Island Water Sports Read Case StudyI really can’t say enough about how impressed we’ve been with the customer service and the product we receive from Starboard Suite. They have gone above and beyond in every instance, have provided a solution to every problem and their "can do" approach to each project is refreshing. Heather Tamlyn — Director of Sales & Marketing, Arnold Mackinac Island Ferry Read Case StudyThis has been SUCH an easy program to use- easy to pick up, with the perfect level of customization. They’ve gone above and beyond any time we’ve needed assistance. Suzanne Thompson — General Manager, Palmetto Bay Marina Read Case StudyWe have been in the Lunch & Dinner Cruise boat business for 27 years and after trying several reservation systems we have found Starboard Suite is the one we can stick with. They have the ability to make the difficult things easy. Lance Chambeau — Captain/Owner, River Lady Cruises Read Case StudyStarboard Suite is easy to use; easy to manage; easy to update; and, best of all easy, to integrate with your company’s website. I recommend it. Wayne Stedman — Principal, Pacific Web Foundry Read Case StudySet-up and Training Included Every Starboard Suite system comes with our hassle-free white glove service.” We learn about your business, configure your reservation system for you, and provide free hands-on training for you and your staff. You can even use our test mode” to practice with every aspect of your system before you start taking live reservations. More than just reservations Tools to help you manage and grow your entire operation MARKETING & SEO Reach more customers and increase sales LEARN MORE BOOKING Online, mobile, phone and walk-up bookings, seamlessly integrated LEARN MORE EMAIL AUTOMATION Improve communications, reduce phone calls and collect customer reviews LEARN MORE RE-MARKETING Turn every customer into a repeat customer LEARN MORE MANAGEMENT & REPORTING Manage and get insight into every aspect of your operation LEARN MORE CHECK IN Streamline your customer check-in process LEARN MORE GET IN TOUCH Product Questions Schedule a Call Other Inquiries hello@starboardsuite.com Website Privacy Policy ©2024 Starboard Suite RESERVATION SOLUTIONS for commuter ferriesfor dinner, lunch & sightseeing cruises for private charters & group bookings for whale & dolphin watching tours for cycle boats, tiki boats and party pontoons for banana boats, parasailing & more QUICK LINKS home solutions integrations pricing faqs compare news about IN ASSOCIATION WITH Website Privacy Policy ©2024 Starboard...
Domain Name: STARBOARDSUITE.COM Registry Domain ID: 1655285384_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.name.com Registrar URL: http://www.name.com Updated Date: 2024-04-18T16:51:24Z Creation Date: 2011-05-10T00:14:16Z Registry Expiry Date: 2025-05-10T00:14:16Z Registrar: Name.com, Inc. Registrar IANA ID: 625 Registrar Abuse Contact Email: abuse@name.com Registrar Abuse Contact Phone: 7202492374 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS-1256.AWSDNS-29.ORG Name Server: NS-1566.AWSDNS-03.CO.UK Name Server: NS-185.AWSDNS-23.COM Name Server: NS-712.AWSDNS-25.NET DNSSEC: unsigned >>> Last update of whois database: 2024-05-17T20:09:10Z <<<